PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g23320.2.p
Common NameBRADI_2g23320, LOC100843050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 612aa    MW: 67713.1 Da    PI: 6.6583
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g23320.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-1763109148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT+eEde l +av  + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Bradi2g23320.2.p  63 KGGWTPEEDETLRKAVYAFKGKNWKKIAESFP-DRTEVQCLHRWQKVL 109
                       688*****************************.************986 PP

2Myb_DNA-binding61.12.3e-19115161148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd+ +vd vk++G++ W++Ia+ +  gR +kqc++rw+++l
  Bradi2g23320.2.p 115 KGPWTQEEDDTIVDMVKKHGPRKWSLIAKSLD-GRIGKQCRERWHNHL 161
                       79******************************.*************97 PP

3Myb_DNA-binding63.25.1e-20167209145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WTteE++ lv+a++++G++ W+ Ia+ ++ gRt++++k++w+
  Bradi2g23320.2.p 167 KEAWTTEEEQVLVKAHHLHGNR-WAEIAKLLP-GRTDNSIKNHWN 209
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.71158109IPR017930Myb domain
SMARTSM007171.1E-1462111IPR001005SANT/Myb domain
PfamPF002492.0E-1563109IPR001005SANT/Myb domain
SuperFamilySSF466892.23E-1564119IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-2465126IPR009057Homeodomain-like
CDDcd001674.18E-1366109No hitNo description
PROSITE profilePS5129431.468110165IPR017930Myb domain
SuperFamilySSF466892.92E-31112208IPR009057Homeodomain-like
SMARTSM007176.6E-17114163IPR001005SANT/Myb domain
PfamPF002491.8E-17115161IPR001005SANT/Myb domain
CDDcd001674.19E-15117161No hitNo description
Gene3DG3DSA:1.10.10.609.2E-27127169IPR009057Homeodomain-like
PROSITE profilePS5129423.561166216IPR017930Myb domain
SMARTSM007171.7E-17166214IPR001005SANT/Myb domain
PfamPF002491.0E-17167210IPR001005SANT/Myb domain
CDDcd001675.30E-14169209No hitNo description
Gene3DG3DSA:1.10.10.604.6E-23170215IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MCEMKVEERG GCTESRQHLE LSSPSASEEG SYGGYARMSP AVSSPADSIS GRRRTSGPVR  60
RAKGGWTPEE DETLRKAVYA FKGKNWKKIA ESFPDRTEVQ CLHRWQKVLD PELIKGPWTQ  120
EEDDTIVDMV KKHGPRKWSL IAKSLDGRIG KQCRERWHNH LDPQIRKEAW TTEEEQVLVK  180
AHHLHGNRWA EIAKLLPGRT DNSIKNHWNS SVRKRIDDYS TRTVMPVPLH ATHIDLKHAA  240
ELSSAENHID LNKEPSISLK DRPVIVDHSD LIQSPRVCSL KNIKGCSDFL SLAMPTAQPL  300
TLCEASVSDD SAVALAIMGL KMDSGHDKDM QLKCVSENSL EISLSNERGL KIDLITNKMR  360
PSGLGKSEGE IANIGCESPS QNEAGSLGSL CYWIPMLDDT DLAHSPVFST HNVRENSGIG  420
FQSPTGYTTP SPTEGKKSDQ LSVESILKSA AENFPSTPSI LRRRKREKPT PAQDCELRIE  480
TNSDSFETPI GNFTTDSPHS FKTASFLSFS HLDDQGLPAD LGKCDVSPSY RLRSKRMAVL  540
KTIEKHLDFS SDAMDICDTS GVLKSACRNS ESINSSTDIS SVEDEKMGAG HMIGLETLIN  600
DFAHTRKLDA S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-69622165159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-69622165159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1461468RRRKREKP
2462467RRKREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568309.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
RefseqXP_010231305.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
TrEMBLA0A0Q3K5700.0A0A0Q3K570_BRADI; Uncharacterized protein
STRINGBRADI2G23320.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-103myb domain protein 3r-5